Details of the Target
General Information of Target
| Target ID | LDTP00370 | |||||
|---|---|---|---|---|---|---|
| Target Name | Heat shock protein beta-6 (HSPB6) | |||||
| Gene Name | HSPB6 | |||||
| Gene ID | 126393 | |||||
| Synonyms |
Heat shock protein beta-6; HspB6; Heat shock 20 kDa-like protein p20 |
|||||
| 3D Structure | ||||||
| Sequence |
MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSV
ALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRR YRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Small heat shock protein (HSP20) family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Seems to have versatile functions in various biological processes. Plays a role in regulating muscle function such as smooth muscle vasorelaxation and cardiac myocyte contractility. May regulate myocardial angiogenesis implicating KDR. Overexpression mediates cardioprotection and angiogenesis after induced damage. Stabilizes monomeric YWHAZ thereby supporting YWHAZ chaperone-like activity.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C46(1.89) | LDD3340 | [1] | |
Competitor(s) Related to This Target

