Details of the Target
General Information of Target
| Target ID | LDTP00347 | |||||
|---|---|---|---|---|---|---|
| Target Name | Claudin-4 (CLDN4) | |||||
| Gene Name | CLDN4 | |||||
| Gene ID | 1364 | |||||
| Synonyms |
CPER; CPETR1; WBSCR8; Claudin-4; Clostridium perfringens enterotoxin receptor; CPE-R; CPE-receptor; Williams-Beuren syndrome chromosomal region 8 protein |
|||||
| 3D Structure | ||||||
| Sequence |
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG
QMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGL LCCNCPPRTDKPYSAKYSAARSAAASNYV |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Claudin family
|
|||||
| Subcellular location |
Cell junction, tight junction
|
|||||
| Function |
Channel-forming tight junction protein that mediates paracellular chloride transport in the kidney. Plays a critical role in the paracellular reabsorption of filtered chloride in the kidney collecting ducts. Claudins play a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K196(10.00) | LDD0277 | [1] | |