Details of the Target
General Information of Target
| Target ID | LDTP00269 | |||||
|---|---|---|---|---|---|---|
| Target Name | C-C chemokine receptor-like 2 (CCRL2) | |||||
| Gene Name | CCRL2 | |||||
| Gene ID | 9034 | |||||
| Synonyms |
CCR11; CCR6; CKRX; CRAM; HCR; C-C chemokine receptor-like 2; Chemokine receptor CCR11; Chemokine receptor X; Putative MCP-1 chemokine receptor |
|||||
| 3D Structure | ||||||
| Sequence |
MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVV
LILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFF NCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYK CAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLV FAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLY AFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV |
|||||
| Target Bioclass |
GPCR
|
|||||
| Family |
G-protein coupled receptor 1 family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Receptor for CCL19 and chemerin/RARRES2. Does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. Plays a critical role for the development of Th2 responses.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K180(4.82) | LDD0277 | [1] | |
|
BTD Probe Info |
![]() |
C181(1.93) | LDD2094 | [2] | |
Competitor(s) Related to This Target
References


