Details of the Target

General Information of Target

Target ID LDTP00234
Target Name Guided entry of tail-anchored proteins factor 1 (GET1)
Gene Name GET1
Gene ID 7485
Synonyms
CHD5; WRB; Guided entry of tail-anchored proteins factor 1; Congenital heart disease 5 protein; Tail-anchored protein insertion receptor WRB; Tryptophan-rich basic protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFMSRVLQKDAEQESQMRAEIQDMKQEL
STVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIKWVISVAFYVLQAALMISLI
WKYYSVPVAVVPSKWITPLDRLVAFPTRVAGGVGITCWILVCNKVVAIVLHPFS
Target Bioclass
Transporter and channel
Family
WRB/GET1 family
Subcellular location
Endoplasmic reticulum membrane
Function
Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). Together with CAMLG/GET2, acts as a membrane receptor for soluble GET3/TRC40, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. Required to ensure correct topology and ER insertion of CAMLG.
Uniprot ID
O00258
Ensemble ID
ENST00000380708.5
HGNC ID
HGNC:12790

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
COLO678 SNV: p.S32A DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K41(7.69); K91(10.00)  LDD0277  [1]
DBIA
 Probe Info  		C1496(1.44)  LDD3310  [2]
Acrolein
 Probe Info  		C157(0.00); C162(0.00)  LDD0224  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 22RV1 C1496(1.38)  LDD2243  [2]
 LDCM0023  KB03 22RV1 C1496(2.34)  LDD2660  [2]
 LDCM0024  KB05 COLO792 C1496(1.44)  LDD3310  [2]
 LDCM0109  NEM HeLa C157(0.00); C162(0.00)  LDD0224  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Catechol O-methyltransferase (COMT) Cation-dependent O-methyltransferase family P21964
Heme oxygenase 2 (HMOX2) Heme oxygenase family P30519
Phospholipid phosphatase 4 (PLPP4) PA-phosphatase related phosphoesterase family Q5VZY2
1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (ABHD5) Peptidase S33 family Q8WTS1
Tyrosine-protein phosphatase non-receptor type 9 (PTPN9) Protein-tyrosine phosphatase family P43378
Serine palmitoyltransferase small subunit A (SPTSSA) SPTSS family Q969W0
Very-long-chain enoyl-CoA reductase (TECR) Steroid 5-alpha reductase family Q9NZ01
Transporter and channel
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
High affinity cationic amino acid transporter 1 (SLC7A1) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family P30825
Apolipoprotein A-II (APOA2) Apolipoprotein A2 family P02652
H(+)/Cl(-) exchange transporter 7 (CLCN7) Chloride channel (TC 2.A.49) family P51798
Cytochrome c oxidase assembly protein COX20, mitochondrial (COX20) COX20 family Q5RI15
Transmembrane 4 L6 family member 19 (TM4SF19) L6 tetraspanin family Q96DZ7
Aquaporin-1 (AQP1) MIP/aquaporin (TC 1.A.8) family P29972
Transferrin receptor protein 1 (TFRC) Peptidase M28 family P02786
Thiamine transporter 2 (SLC19A3) Reduced folate carrier (RFC) transporter (TC 2.A.48) family Q9BZV2
Leukocyte surface antigen CD53 (CD53) Tetraspanin (TM4SF) family P19397
Solute carrier family 35 member E3 (SLC35E3) TPT transporter family Q7Z769
Guided entry of tail-anchored proteins factor CAMLG (CAMLG) . P49069
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
C-C motif chemokine 4-like (CCL4L1; CCL4L2) Intercrine beta (chemokine CC) family Q8NHW4
Other
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Apolipoprotein L2 (APOL2) Apolipoprotein L family Q9BQE5
Ergosterol biosynthetic protein 28 homolog (ERG28) ERG28 family Q9UKR5
ORM1-like protein 3 (ORMDL3) ORM family Q8N138
Stress-associated endoplasmic reticulum protein 2 (SERP2) RAMP4 family Q8N6R1
Ras guanyl-releasing protein 3 (RASGRP3) RASGRP family Q8IV61
Receptor-transporting protein 2 (RTP2) TMEM7 family Q5QGT7
CD302 antigen (CD302) . Q8IX05
Transmembrane protein 42 (TMEM42) . Q69YG0

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.