Details of the Target
General Information of Target
| Target ID | LDTP00230 | |||||
|---|---|---|---|---|---|---|
| Target Name | Agouti-related protein (AGRP) | |||||
| Gene Name | AGRP | |||||
| Gene ID | 181 | |||||
| Synonyms |
AGRT; ART; Agouti-related protein |
|||||
| 3D Structure | ||||||
| Sequence |
MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAE
EDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCR KLGTAMNPCSRT |
|||||
| Target Type |
Clinical trial
|
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R. Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_5 Probe Info |
![]() |
C129(20.00) | LDD2227 | [1] | |
Competitor(s) Related to This Target

