Details of the Target
General Information of Target
| Target ID | LDTP00215 | |||||
|---|---|---|---|---|---|---|
| Target Name | Rho-related GTP-binding protein RhoD (RHOD) | |||||
| Gene Name | RHOD | |||||
| Gene ID | 29984 | |||||
| Synonyms |
ARHD; Rho-related GTP-binding protein RhoD; Rho-related protein HP1; RhoHP1 |
|||||
| 3D Structure | ||||||
| Sequence |
MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQV
KGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCK KVPIIVVGCKTDLRKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVH AVFQEAAEVALSSRGRNFWRRITQGFCVVT |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Small GTPase superfamily, Rho family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Involved in endosome dynamics. May coordinate membrane transport with the function of the cytoskeleton. Involved in the internalization and trafficking of activated tyrosine kinase receptors such as PDGFRB. Participates in the reorganization of actin cytoskeleton; the function seems to involve WHAMM and includes regulation of filopodia formation and actin filament bundling. Can modulate the effect of DAPK3 in reorganization of actin cytoskeleton and focal adhesion dissolution.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K121(10.00) | LDD0277 | [1] | |
|
DBIA Probe Info |
 |
C119(1.63) | LDD3312 | [2] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD0162 | [3] | |
|
IPM Probe Info |
 |
N.A. | LDD0025 | [4] | |
|
JW-RF-010 Probe Info |
 |
N.A. | LDD0026 | [4] | |
|
TFBX Probe Info |
 |
C171(0.00); C28(0.00) | LDD0027 | [4] | |
|
NAIA_5 Probe Info |
 |
C129(0.00); C171(0.00); C28(0.00) | LDD2223 | [5] | |
Competitor(s) Related to This Target
References