Details of the Target

General Information of Target

Target ID	LDTP00211
Target Name	Activator of apoptosis harakiri (HRK)
Gene Name	HRK
Gene ID	8739
Synonyms	BID3; Activator of apoptosis harakiri; BH3-interacting domain-containing protein 3; Neuronal death protein DP5
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAP APGALPTYWPWLCAAAQVAALAAWLLGRRNL
Target Bioclass	Other
Subcellular location	Membrane
Function	Promotes apoptosis.
Uniprot ID	O00198
Ensemble ID	ENST00000257572.5
HGNC ID	HGNC:5185

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 1 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
IA-alkyne Probe Info			N.A.	LDD0151	[1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transporter and channel

Click To Hide/Show 1 Protein(s) Interacting with This Target

Protein name				Family	Uniprot ID
Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP)				MAM33 family	Q07021

References

1	Sequence-Based Prediction of Cysteine Reactivity Using Machine Learning. Biochemistry. 2018 Jan 30;57(4):451-460. doi: 10.1021/acs.biochem.7b00897. Epub 2017 Oct 26.