Details of the Target

General Information of Target

Target ID LDTP00179
Target Name Small ubiquitin-related modifier 5 (SUMO1P1)
Gene Name SUMO1P1
Synonyms
SUMO5; UBL2; UBL6; Small ubiquitin-related modifier 5; SUMO-5; SUMO1 pseudogene 1; Ubiquitin-like 2; Ubiquitin-like 6
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSDLEAKPSTEHLGDKIKDEDIKLRVIGQDSSEIHFKVKMTTPLKKLKKSYCQRQGVPVN
SLRFLFEGQRIADNHTPEELGMEEEDVIEVYQEQIGGHSTV
Target Bioclass
Other
Family
Ubiquitin family, SUMO subfamily
Subcellular location
Nucleus
Function
Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Regulates the life cycle of promyelocytic leukemia nuclear bodies (PML-NBs). PolySUMO1P1/SUMO5 conjugation on 'Lys-160' of PML facilitates recruitment of PML-NB components, which enlarges PML-NB. SUMO1P1/SUMO5 also increases polySUMO2/3 conjugation of PML, resulting in RNF4-mediated disruption of PML-NBs.
Uniprot ID
G2XKQ0
HGNC ID
HGNC:33148

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Acrolein
 Probe Info  		N.A.  LDD0217  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [1]
 LDCM0109  NEM HeLa N.A.  LDD0223  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
E3 SUMO-protein ligase PIAS2 (PIAS2) PIAS family O75928
E3 ubiquitin-protein ligase TRIM23 (TRIM23) Arf family P36406
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
SUMO-activating enzyme subunit 2 (UBA2) Ubiquitin-activating E1 family Q9UBT2
SUMO-conjugating enzyme UBC9 (UBE2I) Ubiquitin-conjugating enzyme family P63279
Protein ARK2N (ARK2N) . Q96B23
SET-binding protein (SETBP1) . Q9Y6X0
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
DNA-binding protein SATB1 (SATB1) CUT homeobox family Q01826
Estrogen-related receptor gamma (ESRRG) Nuclear hormone receptor family P62508
Transcription factor SOX-5 (SOX5) . P35711
Zinc finger and BTB domain-containing protein 26 (ZBTB26) . Q9HCK0
Zinc finger and BTB domain-containing protein 6 (ZBTB6) . Q15916
Other
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclin-dependent kinases regulatory subunit 1 (CKS1B) CKS family P61024
Protein FAM118B (FAM118B) FAM118 family Q9BPY3
Protein FAM200A (FAM200A) FAM200 family Q8TCP9
Inactive peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) FKBP6 family O75344
Keratin-associated protein 9-2 (KRTAP9-2) KRTAP type 9 family Q9BYQ4
Late cornified envelope protein 2A (LCE2A) LCE family Q5TA79
Late cornified envelope protein 2D (LCE2D) LCE family Q5TA82
MAPK-interacting and spindle-stabilizing protein-like (MAPK1IP1L) MISS family Q8NDC0
NGFI-A-binding protein 2 (NAB2) NAB family Q15742
Heterogeneous nuclear ribonucleoproteins C1/C2 (HNRNPC) RRM HNRPC family P07910
Small ubiquitin-related modifier 1 (SUMO1) Ubiquitin family P63165
Axin-1 (AXIN1) . O15169
Ectodysplasin-A receptor-associated adapter protein (EDARADD) . Q8WWZ3
Lethal(3)malignant brain tumor-like protein 3 (L3MBTL3) . Q96JM7
Protein ZNRD2 (ZNRD2) . O60232

References

1 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.