Details of the Target
General Information of Target
Target ID | LDTP00177 | |||||
---|---|---|---|---|---|---|
Target Name | Short transmembrane mitochondrial protein 1 (STMP1) | |||||
Gene Name | STMP1 | |||||
Gene ID | 647087 | |||||
Synonyms |
C7orf73; Short transmembrane mitochondrial protein 1 |
|||||
3D Structure | ||||||
Sequence |
MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPSA
|
|||||
Target Bioclass |
Other
|
|||||
Family |
STMP1 family
|
|||||
Subcellular location |
Mitochondrion inner membrane
|
|||||
Function |
Microprotein involved in mitochondrial respiratory chain complex III (ubiquinol-cytochrome c oxidoreductase) and complex IV (mitochondrial cytochrome c oxidase complex) assembly. Required for the formation of mitochondrial supercomplexes (SCs). Also required for the activation of the NLRP3 inflammasome.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K35(10.00); K43(3.39) | LDD0277 | [1] |