Details of the Target
General Information of Target
| Target ID | LDTP00177 | |||||
|---|---|---|---|---|---|---|
| Target Name | Short transmembrane mitochondrial protein 1 (STMP1) | |||||
| Gene Name | STMP1 | |||||
| Gene ID | 647087 | |||||
| Synonyms |
C7orf73; Short transmembrane mitochondrial protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPSA
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
STMP1 family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function |
Microprotein involved in mitochondrial respiratory chain complex III (ubiquinol-cytochrome c oxidoreductase) and complex IV (mitochondrial cytochrome c oxidase complex) assembly. Required for the formation of mitochondrial supercomplexes (SCs). Also required for the activation of the NLRP3 inflammasome.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K35(10.00); K43(3.39) | LDD0277 | [1] | |

