Details of the Target
General Information of Target
| Target ID | LDTP00172 | |||||
|---|---|---|---|---|---|---|
| Target Name | Mapk-regulated corepressor-interacting protein 1 (MCRIP1) | |||||
| Gene Name | MCRIP1 | |||||
| Gene ID | 348262 | |||||
| Synonyms |
FAM195B; GRAN2; Mapk-regulated corepressor-interacting protein 1; Granulin-2; Protein FAM195B |
|||||
| 3D Structure | ||||||
| Sequence |
MTSSPVSRVVYNGKRTSSPRSPPSSSEIFTPAHEENVRFIYEAWQGVERDLRGQVPGGER
GLVEEYVEKVPNPSLKTFKPIDLSDLKRRSTQDAKKS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
MCRIP family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
The phosphorylation status of MCRIP1 functions as a molecular switch to regulate epithelial-mesenchymal transition. Unphosphorylated MCRIP1 binds to and inhibits the transcriptional corepressor CTBP(s). When phosphorylated by MAPK/ERK, MCRIP1 releases CTBP(s) resulting in transcriptional silencing of the E-cadherin gene and induction of epithelial-mesenchymal transition.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K87(10.00) | LDD0277 | [1] | |
|
Probe 1 Probe Info |
![]() |
Y11(19.34) | LDD3495 | [2] | |
References


