Details of the Target
General Information of Target
Target ID | LDTP00066 | |||||
---|---|---|---|---|---|---|
Target Name | Metallo-beta-lactamase domain-containing protein 1 (MBLAC1) | |||||
Gene Name | MBLAC1 | |||||
Gene ID | 255374 | |||||
Synonyms |
Metallo-beta-lactamase domain-containing protein 1; EC 3.1.27.-; Endoribonuclease MBLAC1 |
|||||
3D Structure | ||||||
Sequence |
MRTEPLCGASPLLVPGDPYSVVVLLQGYAEPEGVGDAVRADGSVTLVLPQTRGPASSHRE
SPRGSGGAEAALEEAARGPILVDTGGPWAREALLGALAGQGVAPGDVTLVVGTHGHSDHI GNLGLFPGAALLVSHDFCLPGGRYLPHGLGEGQPLRLGPGLEVWATPGHGGQRDVSVVVA GTALGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVVADVVVPGHGPPFRVLRE ASQPETEGGGNSQQEPVVGDEEPALH |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Metallo-beta-lactamase superfamily, Glyoxalase II family
|
|||||
Subcellular location |
Cytoplasm, cytosol
|
|||||
Function |
Endoribonuclease that catalyzes the hydrolysis of histone-coding pre-mRNA 3'-end. Involved in histone pre-mRNA processing during the S-phase of the cell cycle, which is required for entering/progressing through S-phase. Cleaves histone pre-mRNA at a major and a minor cleavage site after the 5'-ACCCA-3' and the 5'-ACCCACA-3' sequence, respectively, and located downstream of the stem-loop. May require the presence of the HDE element located at the histone pre-RNA 3'-end to avoid non-specific cleavage.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C7(0.72) | LDD3445 | [1] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [2] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0372 | CL103 | HEK-293T | C7(1.12) | LDD1576 | [3] |
LDCM0376 | CL107 | HEK-293T | C7(1.17) | LDD1580 | [3] |
LDCM0381 | CL111 | HEK-293T | C7(0.98) | LDD1585 | [3] |
LDCM0385 | CL115 | HEK-293T | C7(1.26) | LDD1589 | [3] |
LDCM0389 | CL119 | HEK-293T | C7(1.25) | LDD1593 | [3] |
LDCM0394 | CL123 | HEK-293T | C7(1.10) | LDD1598 | [3] |
LDCM0398 | CL127 | HEK-293T | C7(1.12) | LDD1602 | [3] |
LDCM0402 | CL15 | HEK-293T | C7(1.22) | LDD1606 | [3] |
LDCM0415 | CL27 | HEK-293T | C7(1.49) | LDD1619 | [3] |
LDCM0418 | CL3 | HEK-293T | C7(0.82) | LDD1622 | [3] |
LDCM0428 | CL39 | HEK-293T | C7(1.02) | LDD1632 | [3] |
LDCM0455 | CL63 | HEK-293T | C7(0.73) | LDD1658 | [3] |
LDCM0481 | CL87 | HEK-293T | C7(0.90) | LDD1684 | [3] |
LDCM0494 | CL99 | HEK-293T | C7(0.87) | LDD1697 | [3] |
LDCM0495 | E2913 | HEK-293T | C7(1.08) | LDD1698 | [3] |
LDCM0468 | Fragment33 | HEK-293T | C7(1.18) | LDD1671 | [3] |
LDCM0022 | KB02 | 42-MG-BA | C7(1.36) | LDD2244 | [1] |
LDCM0023 | KB03 | SW1783 | C7(1.22) | LDD3038 | [1] |
LDCM0024 | KB05 | SNU-5 | C7(0.72) | LDD3445 | [1] |
References