Details of the Target
General Information of Target
Target ID | LDTP00006 | |||||
---|---|---|---|---|---|---|
Target Name | Negative regulator of P-body association (NBDY) | |||||
Gene Name | NBDY | |||||
Gene ID | 550643 | |||||
Synonyms |
LINC01420; Negative regulator of P-body association; P-body dissociating protein; Protein NoBody |
|||||
3D Structure | ||||||
Sequence |
MGDQPCASGRSTLPPGNAREAKPPKKRCLLAPRWDYPEGTPNGGSTTLPSAPPPASAGLK
SHPPPPEK |
|||||
Target Bioclass |
Other
|
|||||
Subcellular location |
Cytoplasm, P-body
|
|||||
Function | Promotes dispersal of P-body components and is likely to play a role in the mRNA decapping process. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
AZ-9 Probe Info |
![]() |
D3(10.00) | LDD2209 | [1] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0174 | [2] | |
TFBX Probe Info |
![]() |
C6(0.00); C28(0.00) | LDD0027 | [3] | |
ENE Probe Info |
![]() |
N.A. | LDD0006 | [4] | |
IPM Probe Info |
![]() |
N.A. | LDD0005 | [4] | |
VSF Probe Info |
![]() |
N.A. | LDD0007 | [4] | |
Phosphinate-6 Probe Info |
![]() |
C28(0.00); C6(0.00) | LDD0018 | [5] |
The Interaction Atlas With This Target
References